PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.25327s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 104aa    MW: 12131.8 Da    PI: 9.5042
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.25327s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof108.63.2e-342170251
                zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPv 51
                          ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+  
  Araha.25327s0008.1.p 21 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNIST 70
                          5789*******************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-251371IPR003851Zinc finger, Dof-type
PfamPF027011.4E-292375IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.622579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MQDPAAYYQT MMAKQQPQFA EQEQLKCPRC DSPNTKFCYY NNYNLSQPRH FCKSCRRYWT  60
KGGALRNIST SLTHKDTTNK DTTFKRSKTN LPMQSLLVLN EFC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0175658e-75AB017565.1 Arabidopsis thaliana adof2 mRNA for Dof zinc finger protein, complete cds.
GenBankAB0230458e-75AB023045.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MXL8.
GenBankAY0458478e-75AY045847.1 Arabidopsis thaliana putative Dof zinc finger protein (At3g21270) mRNA, complete cds.
GenBankAY1503918e-75AY150391.1 Arabidopsis thaliana Dof zinc finger protein (At3g21270) mRNA, complete cds.
GenBankCP0026868e-75CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002883295.12e-46hypothetical protein ARALYDRAFT_898570
SwissprotO821555e-37DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLD7L0R03e-46D7L0R0_ARALL; Putative uncharacterized protein
STRINGscaffold_302540.18e-46(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-38DOF zinc finger protein 1